PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021629-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 795aa    MW: 88137.9 Da    PI: 6.0626
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021629-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.9e-20118173156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t  q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  AHYPO_021629-RA 118 KKRYHRHTIRQIQEMEALFRECPHPDDKQRMKLSQELGLKPRQVKFWFQNRRTQMK 173
                      6888999**********************************************998 PP

2START144.21.3e-453225572206
                      HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS....................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT- CS
            START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv...................dsgealrasgvvdmvlallveellddkeqWdetl 76 
                      la + ++el+k+   +ep+W      +n ++vl ++e s+                     ++ea r++++v+m++ +lv +lld   +W e +
  AHYPO_021629-RA 322 LAMSSMDELLKLCHTNEPLWIPNC--SNTMDVLNIEEYSRMftnwpphhngdplkphysaLRTEATRDKALVIMNSINLVDSLLDAD-KWVELF 412
                      677899**************9999..777777777777666777778888*************************************.****** PP

                      S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEE CS
            START  77 a....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe..sssvvRaellpSgiliep 156
                      +    +a+t++ + sg      g l+lm+aelq+lsplvp R+ +f+Ry+    ++g wv+vd  vds q   +  + ++ R +++pSg++i++
  AHYPO_021629-RA 413 PsivsRAKTIQILASGvsghasGSLHLMYAELQVLSPLVPtRETYFLRYCHHnAEDGMWVVVDFPVDSFQGAFQlsQNNIPRYRRRPSGCIIQD 506
                      ****************************************************9***************99988888999*************** PP

                      ECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 157 ksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                      ++ng+skvtw+eh++  g  p h++++  v + +a+gak+w+a lqrqce+
  AHYPO_021629-RA 507 MPNGYSKVTWIEHTEILGEKPiHQIFNLYVDNMMAFGAKRWLAVLQRQCER 557
                      ***************9999999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-20104176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-21112180IPR009057Homeodomain-like
PROSITE profilePS5007117.054115175IPR001356Homeobox domain
SMARTSM003895.2E-18116179IPR001356Homeobox domain
CDDcd000861.95E-18118176No hitNo description
PfamPF000462.1E-17118173IPR001356Homeobox domain
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084843.348312560IPR002913START domain
SuperFamilySSF559614.67E-30313559No hitNo description
CDDcd088759.47E-108316556No hitNo description
SMARTSM002345.2E-30321557IPR002913START domain
PfamPF018521.7E-38322557IPR002913START domain
SuperFamilySSF559612.56E-5577765No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MYGDCQVALP STMGGAGENG IPSTPDCSSL IFSSPMRNPN NNHLNSFSFM SSLPPTFHPF  60
SSIMPVKEEI RGKEEMMESL SGSELNMEGQ GGVSGNELDS ISGDLLNQNQ SQPPGSKKKR  120
YHRHTIRQIQ EMEALFRECP HPDDKQRMKL SQELGLKPRQ VKFWFQNRRT QMKAQQDRTD  180
NVILRAENDN LKNENYRLQA VLRSLICPGC GGSSILGEVE YDEHQLHIEN ARLKEELDRV  240
CAVASRYTGR SLQTLGPPAT LLQAPPSLDL DMGIYSRHFQ DSIPPCTQLL AMPLLPSDYP  300
NGGGNTGRGL IMDEERPLAM ELAMSSMDEL LKLCHTNEPL WIPNCSNTMD VLNIEEYSRM  360
FTNWPPHHNG DPLKPHYSAL RTEATRDKAL VIMNSINLVD SLLDADKWVE LFPSIVSRAK  420
TIQILASGVS GHASGSLHLM YAELQVLSPL VPTRETYFLR YCHHNAEDGM WVVVDFPVDS  480
FQGAFQLSQN NIPRYRRRPS GCIIQDMPNG YSKVTWIEHT EILGEKPIHQ IFNLYVDNMM  540
AFGAKRWLAV LQRQCERVAS LMARNVSDHG VIQSAEARKN FMKLAQRMIR TLCVNISTSG  600
GQSWTALSEN AEDTVRITTR KIMEPGQPNG LILCAVTTTW LPYSHEQMAS NSSQNVELML  660
QESCTDASGS LVVYSTLEVD YIQLVMSGED PSCIPLLPTG FSIIPLERTT STPDANDSDT  720
NNHHTTAGCL LTVGIQVHAS AIPNAKLNLS SVNAINSHIC SVVHQINVVL GNTNGSSNTN  780
NNNINACVAA TSND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677364.10.0PREDICTED: homeobox-leucine zipper protein HDG5 isoform X1
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLA0A0J8CCN10.0A0A0J8CCN1_BETVU; Uncharacterized protein
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7